The Liberty PRIME™ peptide synthesizer is the most advanced platform available for microwave peptide synthesis. It features a revolutionary one-pot deprotection and coupling process allowing for a remarkable 2 minute cycle time with only 8.5mL waste per cycle (at 0.1 mmol).
• Individual 20mer’s every 45 minutes
• Batches of 24 peptides (20mer’s) every 20 hours with only 4.5 liters total waste produced
Unique Chemistry
• One-pot coupling and deprotection chemistry (patented)
• CarboMAX™ coupling chemistry (patented)
• Microwave deprotection and coupling (patented)
Features
• Unprecedented 2 min cycle time
• Unrivaled 8.5mL waste per cycle at (0.1 mmol)
• Automated synthesis of up to 24 peptides
• Precise calibration-free delivery of all reagents
• Integrated Camera (optional)
Liberty 2.0 | Liberty Blue 2.0 | Liberty PRIME 2.0 | |
Cycle Time (at 0.1mmol) | 12 minutes | 4 minutes | 2.5 minutes |
System Waste (at 0.1mmol) | 32 mL | 16 mL | 10 mL |
Scale Range | 0.005 – 5 mmol | 0.005 – 5 mmol | 0.005 – 5 mmol |
Headspace Flushing | No | Yes | Yes |
Amino Acid Positions | 27 | 27 | 30 |
External Reagent Positions | 4 | 4 | 5 |
RV Camera | No | Yes | Yes |
LED Visual Feedback | No | Yes | Yes |
High-Throughput Options | HT4 | HT4, HT12 | HT4, HT12, HT24 |
Optional Accessories | N/A | N/A | Full cGMP Compliance Package |
Epimer | DIC/Oxyma (%) | CarboMAX (%) |
D-Asp | 0.23 | 0.31 |
D-Ala | 0.33 | 0.25 |
D-Arg | 0.29 | 0.2 |
D-Glu | 0.39 | 0.3 |
D-His | N/A | N/A |
D-Ile | < 0.10 | < 0.10 |
L-allo Ile | < 0.10 | < 0.10 |
D-allo Ile | < 0.10 | < 0.10 |
D-Leu | 0.17 | 0.13 |
D-Lys | < 0.10 | 0.1 |
D-Phe | 0.2 | 0.16 |
D-Ser | 0.16 | 0.12 |
D-Thr | < 0.10 < 0.10 < 0.10 | < 0.10 |
D-Trp | 0.24 | < 0.10 |
D-Tyr | 0.12 | 0.11 |
D-Val | < 0.10 | < 0.10 |
Peptide | Sequence | % Crude Purity DIC/Oxyma | % Crude Purity CarboMAX |
Thymosin | SDAAVDTSSEITTKDLKEKKEVVEEAEN | 63 | 75 |
GRP | VPLPAGGGTVLTKMYPRGNHWAVGHLM | 62 | 74 |
Bivalirudin | fPRPGGGGNGDFEEIPEEYL | 80 | 82 |
1-34PTH | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | 67 | 85 |
35-55MOG | MEVGWYRSPFSRVVHLYRNGK | 77 | 91 |
Magainin 1 | GIGKFLHSAGKFGKAFVGEIMKS | 71 | 79 |
Dynorphin A | YGGFLRRIRPKLKWDNQ | 74 | 82 |
Liraglutide | HAEGTFTSDVSSYLEGQAAK(γ-Glu-palmitoyl) EFIAWLVRGRG | 74 | 88 |
Scale | Cycle Time | AA Equiv | Waste/Cycle |
0.1 mmol | 2 m 10 s | 5 | 8.5 ml |
0.3 mmol | 3 m 40 s | 5 | 20 ml |
0.4 mmol | 3 m 50 s | 4 | 20 ml |
Register to receive email updates on our new products, special promotions and events.
Home » Instruments » Liberty Prime 2.0
© Copyright 2025. All Rights Reserved.
A Beun - De Ronde company